WWC2 Rabbit Polyclonal Antibody

CAT#: TA330829

Rabbit Polyclonal Anti-WWC2 Antibody

Product Images

Host: Rabbit; Target Name: WWC2; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-WWC2 antibody is: synthetic peptide directed towards the C-terminal region of Human WWC2. Synthetic peptide located within the following region: RLLKQAEKQAEQSKEEQKQGLNAEKLMRQVSKDVCRLREQSQKVPRQVQS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 133 kDa
• Gene Name: WW and C2 domain containing 2
• Database Link:
  NP_079225
  Entrez Gene 80014 Human
  UniProt ID Q6AWC2
• Background: The function of this protein remains unknown.
• Synonyms: BOMB
• Note: Dog: 100%; Pig: 100%; Human: 100%; Horse: 93%; Rat: 92%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%; Yeast: 83%