TTC26 Rabbit Polyclonal Antibody

SKU TA330805

Rabbit Polyclonal Anti-TTC26 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TTC26 antibody is: synthetic peptide directed towards the N-terminal region of Human TTC26. Synthetic peptide located within the following region: VGRGVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: tetratricopeptide repeat domain 26
• Database Link:
  NP_079202
  A0AVF1
• Background: TTC26 may play a critical role in ciliogenesis and normal cilia function.
• Synonyms: dyf-13; DYF13; IFT56
• Note: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 92%; Guinea pig: 83%

Reference Data