TTC26 Rabbit Polyclonal Antibody

CAT#: TA330804

Rabbit Polyclonal Anti-TTC26 Antibody

Product Images

Host: Rabbit; Target Name: TTC26; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TTC26 antibody is: synthetic peptide directed towards the N-terminal region of Human TTC26. Synthetic peptide located within the following region: LEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: tetratricopeptide repeat domain 26
• Database Link:
  NP_079202
  Entrez Gene 79989 Human
  UniProt ID A0AVF1
• Background: TTC26 may play a critical role in ciliogenesis and normal cilia function.
• Synonyms: dyf-13; DYF13; IFT56
• Note: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Rat: 86%; Guinea pig: 86%; Bovine: 79%; Rabbit: 79%