TMPRSS11E Rabbit Polyclonal Antibody

CAT#: TA330794

Rabbit Polyclonal Anti-TMPRSS11E Antibody


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (2)
Transient overexpression lysate of transmembrane protease, serine 11E (TMPRSS11E)
    • 100 ug

USD 665.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "TMPRSS11E"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TMPRSS11E antibody is: synthetic peptide directed towards the N-terminal region of Human TMPRSS11E. Synthetic peptide located within the following region: CIGLTVHYVRYNQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 25 kDa
Gene Name transmembrane protease, serine 11E
Background TMPRSS11E is a Serine protease which possesses both gelatinolytic and caseinolytic activities. It shows a preference for Arg in the P1 position.
Synonyms DESC1; TMPRSS11E2
Note Human: 100%; Pig: 93%; Horse: 93%; Dog: 92%; Rat: 86%; Guinea pig: 86%; Mouse: 79%
Reference Data
Protein Families Druggable Genome, Protease, Secreted Protein, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.