TMEM68 Rabbit Polyclonal Antibody

SKU TA330779

Rabbit Polyclonal Anti-TMEM68 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TMEM68 antibody is: synthetic peptide directed towards the N-terminal region of Human TMEM68. Synthetic peptide located within the following region: MIDKNQTCGVGQDSVPYMICLIHILEEWFGVEQLEDYLNFANYLLWVFTP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: transmembrane protein 68
• Database Link:
  NP_689630
  Q96MH6
• Background: The function of this protein remains unknown.
• Synonyms: FLJ32370; MGC87778
• Note: Human: 100%; Dog: 92%; Pig: 85%; Rat: 85%; Rabbit: 85%; Horse: 79%; Mouse: 79%; Guinea pig: 77%

Reference Data

• Protein Families: Transmembrane