SLC35E1 Rabbit Polyclonal Antibody

SKU TA330756

Rabbit Polyclonal Anti-SLC35E1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC35E1 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35E1. Synthetic peptide located within the following region: MMTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: solute carrier family 35 member E1
• Database Link:
  NP_079157
  Q96K37
• Background: SLC35E1 is a putative transporter.
• Synonyms: DKFZp564G0462; FLJ14251; FLJ36689; MGC44954
• Note: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Dog: 86%

Reference Data

• Protein Families: Transmembrane