NDNF Rabbit Polyclonal Antibody

CAT#: TA330736

Rabbit Polyclonal Anti-NDNF Antibody

Product Images

Host: Rabbit; Target Name: NDNF; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NDNF antibody is: synthetic peptide directed towards the C-terminal region of Human NDNF. Synthetic peptide located within the following region: NEDQKKREQNQCLGPDIRKKSEKVLCKYFHSQNLQKAVTTETIKGLQPGK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: neuron-derived neurotrophic factor
• Database Link:
  NP_078850
  Entrez Gene 79625 Human
  UniProt ID Q8TB73
• Background: NDNF promotes matrix assembly and cell adhesiveness. It promotes neuron migration, growth and survival as well as neurite outgrowth.
• Synonyms: C4orf31; NORD
• Note: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%