Germany
Japan
United Kingdom
China
CCDC81 Rabbit Polyclonal Antibody
Product Images
Frequently bought together (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Transient overexpression lysate of coiled-coil domain containing 81 (CCDC81), transcript variant 2
USD 665.00
Other products for "CCDC81"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-CCDC81 antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC81. Synthetic peptide located within the following region: ALRKWPSSVLAFPRIELKEMENKLPMETLVEECGENRERKCKLKDQSDKE |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 42 kDa |
| Gene Name | coiled-coil domain containing 81 |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | FLJ16339; FLJ23514 |
| Note | Human: 100%; Rat: 86%; Mouse: 86%; Rabbit: 86% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.