COA1 Rabbit Polyclonal Antibody

SKU TA330693

Rabbit Polyclonal Anti-COA1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-COA1 antibody is: synthetic peptide directed towards the C-terminal region of Human COA1. Synthetic peptide located within the following region: KSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVKKE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 16 kDa
• Gene Name: cytochrome c oxidase assembly factor 1 homolog
• Database Link:
  NP_060694
  Q9GZY4
• Background: The function of this protein remains unknown.
• Synonyms: C7orf44; MITRAC15
• Note: Human: 100%

Reference Data

• Protein Families: Transmembrane