ZC3H7B Rabbit Polyclonal Antibody

CAT#: TA330574

Rabbit Polyclonal Anti-ZC3H7B Antibody

Product Images

WB Suggested Anti-ZC3H7B Antibody Titration: 4ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZC3H7B antibody: synthetic peptide directed towards the N terminal of human ZC3H7B. Synthetic peptide located within the following region: YECSSRCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPQELETFSLLSN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 110 kDa
• Gene Name: zinc finger CCCH-type containing 7B
• Database Link:
  NP_060060
  Entrez Gene 23264 Human
  UniProt ID Q9UGR2
• Background: ZC3H7B is a protein that contains a tetratricopeptide repeat domain. The encoded protein also interacts with the rotavirus non-structural protein NSP3.
• Synonyms: RoXaN
• Note: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%