OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

REST Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA330562
Rabbit Polyclonal Anti-REST Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "REST or NM_005612" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-REST antibody: synthetic peptide directed towards the middle region of human REST. Synthetic peptide located within the following region: PMLPPSAVEEREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSD
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 122 kDa
Gene Name RE1 silencing transcription factor
Database Link
Background REST is a transcriptional repressor which represses neuronal genes in non-neuronal tissues. It is a member of the Kruppel-type zinc finger transcription factor family. It represses transcription by binding a DNA sequence element called the neuron-restrictive silencer element. The protein is also found in undifferentiated neuronal progenitor cells, and it is thought that this repressor may act as a master negative regular of neurogenesis.This gene encodes a transcriptional repressor which represses neuronal genes in non-neuronal tissues. It is a member of the Kruppel-type zinc finger transcription factor family. It represses transcription by binding a DNA sequence element called the neuron-restrictive silencer element. The protein is also found in undifferentiated neuronal progenitor cells, and it is thought that this repressor may act as a master negative regular of neurogenesis. Alternatively spliced transcript variants have been described; however, their full length nature has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Synonyms NRSF; WT6; XBR
Note Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data
Protein Categories Cancer: Bladder, Intracellular Proteins, Nervous system Diseases, Transciption Factors
Protein Families Transcription Factors
Protein Pathways Huntington's disease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Histone deacetylase inhibitors induce medulloblastoma cell death independent of HDACs recruited in REST repression complexes
Alshawli, Wurdak, Wood et al
Mol Genet Genomic Med (2020)
Cited by 6
AI Summary: OriGene’s CRISPR/Cas9 guide RNA system (KN314675) was used in this study to target and knock out the REST gene in medulloblastoma cells, enabling the investigation of REST’s role in cell proliferation and response to HDAC inhibitors.
Snippet: A CRISPR/Cas9 guide RNA system (OriGene, KN314675) was used to target two different DNA sequences in exon 2 of the REST gene (NG_029447.1). Two guide sequences (gRNA1: 5′‐CGCACCTCAGCTTATTATG C‐3′ and gRNA2: 5′‐TGGCAAATGTGGCCTTAACT
Transcription regulation of CDKN1A (p21/CIP1/WAF1) by TRF2 is epigenetically controlled through the REST repressor complex
Hussain, Saha, Purohit et al
Sci Rep (2017) 7 (1), 11541 DOI: 10.1038/s41598-017-11177-1
AI Summary: OriGene products contributed to this study by providing the REST antibody (OriGene#TA330562) for protein detection and the pCMV6-TRF2 plasmid for TRF2 overexpression experiments, enabling investigation of the molecular mechanisms underlying TRF2-mediated repression of p21.
Snippet: … REST (Origene#TA330562), co-REST (Abcam#32631), anti-Rap1 (sc-28197), anti-H3K4Me (Abcam 106165), anti-H3K4Me2 (Abcam 32356). … pCMV6- TRF2 plasmid was purchased from Origene. … REST (Origene#TA330562), co-REST (Abcam#32631), anti-Rap1 (sc-28197), anti-H3K4Me (Abcam 106165), anti-H3K4Me2 (Abcam 32356). … pCMV6- TRF2 plasmid was purchased from Origene. … REST (Origene#TA330562), co-REST (Abcam#32631), anti-Rap1 (sc-28197), anti-H3K4Me (Abcam 106165), anti-H3K4Me2 (Abcam 32356). … pCMV6- TRF2 plasmid was purchased from Origene. …
FigureFigureFigure
ChIP
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products