DCST1 Rabbit Polyclonal Antibody

CAT#: TA330510

Rabbit Polyclonal Anti-DCST1 Antibody

Product Images

WB Suggested Anti-DCST1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Immunohistochemistry with Human Heart lysate tissue at an antibody concentration of 5.0 ug/ml using anti-DCST1 antibody

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DCST1 antibody: synthetic peptide directed towards the C terminal of human DCST1. Synthetic peptide located within the following region: SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 78 kDa
• Gene Name: DC-STAMP domain containing 1
• Database Link:
  NP_689707
  Entrez Gene 149095 Human
  UniProt ID Q5T197
• Background: The function remains unknown.
• Synonyms: FLJ32785; RP11-307C12.10
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 85%; Dog: 79%; Horse: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane