TRIM43 Rabbit Polyclonal Antibody

CAT#: TA330499

Rabbit Polyclonal Anti-TRIM43 Antibody

Product Images

WB Suggested Anti-TRIM43 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIM43 antibody: synthetic peptide directed towards the C terminal of human TRIM43. Synthetic peptide located within the following region: NSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFES
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: tripartite motif containing 43
• Database Link:
  NP_620155
  Entrez Gene 129868 Human
  UniProt ID Q96BQ3
• Background: TRIM43 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger, 1 B30.2/SPRY domain and 1 RING-type zinc finger. The exact function of TRIM43 remains unknown.
• Synonyms: TRIM43A
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome