PCGF5 Rabbit Polyclonal Antibody

SKU TA330483

Rabbit Polyclonal Anti-PCGF5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PCGF5 antibody: synthetic peptide directed towards the N terminal of human PCGF5. Synthetic peptide located within the following region: ATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: polycomb group ring finger 5
• Database Link:
  NP_115749
  Q86SE9
• Background: PCGF5 contains 1 RING-type zinc finger. It is probable component of some Polycomb group (PcG) multiprotein complex, a complex required to maintain the transcriptionally repressive state of some genes.
• Synonyms: RNF159
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 93%; Zebrafish: 79%

Reference Data