OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRAF7 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA330482
Rabbit Polyclonal Anti-TRAF7 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY403153 Transient overexpression lysate of TNF receptor-associated factor 7 (TRAF7) (as WB positive control) 100 ug
$665.00

View other "TRAF7 or NM_032271" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TRAF7 antibody: synthetic peptide directed towards the N terminal of human TRAF7. Synthetic peptide located within the following region: GPAFSAVTTITKADGTSTYKQHCRTPSSSSTLAYSPRDEEDSMPPISTPR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 74 kDa
Gene Name TNF receptor associated factor 7
Database Link
Background Tumor necrosis factor (TNF; see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc RING and/or zinc finger motifs; a coiled-coil (leucine zipper) motif; and a homologous region that defines the TRAF family, the TRAF domain, which is involved in self-association and receptor binding. supplied by OMIM, Apr 2004. ##Evidence-Data-START## Transcript exon combination :: AY569455.1, AK090624.1 ECO:0000332 RNAseq introns :: single sample supports all introns ERS025082, ERS025083 ECO:0000348 ##Evidence-Data-END##
Synonyms RFWD1; RNF119
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Guinea pig: 93%
Reference Data
Protein Categories Cancer: Brain and CNS, Intracellular Proteins
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products