Rnf122 Rabbit Polyclonal Antibody

SKU TA330470

Rabbit Polyclonal Anti-Rnf122 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rnf122 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SLIFCCYFISKLRNQAQSERYGYKEVVLKGDAKKLQLYGTCAVCLEDFKG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 17 kDa
• Gene Name: ring finger protein 122
• Database Link:
  NP_780345
  Q8BP31
• Background: The function of this protein remains unknown.
• Synonyms: FLJ12526; MGC126622
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 85%

Reference Data