FOXM1 Rabbit Polyclonal Antibody

SKU TA330367

Rabbit Polyclonal Anti-FOXM1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXM1 antibody: synthetic peptide directed towards the middle region of human FOXM1. Synthetic peptide located within the following region: ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 84 kDa
• Gene Name: forkhead box M1
• Database Link:
  NP_068772
  Q08050
• Background: FOXM1 is a transcriptional activatory factor. It may play a role in the control of cell proliferation
• Synonyms: FKHL16; FOXM1B; HFH-11; HFH11; HNF-3; INS-1; MPHOSPH2; MPP-2; MPP2; PIG29; TGT3; TRIDENT
• Note: Immunogen sequence homology: Human: 100%; Mouse: 91%; Rabbit: 91%; Rat: 91%; Dog: 83%; Guinea pig: 83%; Pig: 83%

Reference Data

• Protein Families: Transcription Factors