WDR3 Rabbit Polyclonal Antibody

CAT#: TA330338

Rabbit Polyclonal Anti-WDR3 Antibody

Product Images

WB Suggested Anti-WDR3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Hela cell lysate WDR3 is supported by BioGPS gene expression data to be expressed in HeLa

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WDR3 antibody: synthetic peptide directed towards the middle region of human WDR3. Synthetic peptide located within the following region: VIGFNMAGLDYLKRECEAKSEVMFFADATSHLEEKKRKRKKREKLILTLT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 106 kDa
• Gene Name: WD repeat domain 3
• Database Link:
  NP_006775
  Entrez Gene 10885 Human
  UniProt ID Q9UNX4
• Background: WDR3 is a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.This gene encodes a nuclear protein containing 10 WD repeats. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, which usually include a trp-asp at the C-terminal end. Proteins belonging to the WD repeat family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.
• Synonyms: DIP2; UTP12
• Note: Immunogen sequence homology: Bovine: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Guinea pig: 93%; African clawed frog: 92%; Chicken: 85%; Rat: 80%; Zebrafish: 78%

Reference Data

• Protein Families: Druggable Genome