EXOC2 Rabbit Polyclonal Antibody

SKU TA330295

Rabbit Polyclonal Anti-EXOC2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-EXOC2 antibody is: synthetic peptide directed towards the N-terminal region of Human EXOC2. Synthetic peptide located within the following region: MLDLDNDTRPSVLGHLSQTASLKRGSSFQSGRDDTWRYKTPHRVAFVEKL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: exocyst complex component 2
• Database Link:
  NP_060773
  Q96KP1
• Background: The function of this protein remains unknown.
• Synonyms: SEC5; SEC5L1; Sec5p
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 93%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%; Bovine: 85%

Reference Data