Bmp7 Rabbit Polyclonal Antibody

CAT#: TA330252

Rabbit Polyclonal Anti-Bmp7 Antibody

Product Images

WB Suggested Anti-Bmp7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Rat Lung

• 

  Human Skin

• 

  Sample Type : Human kidney (Proteinase K) Primary Antibody Dilution : 1:1000Secondary Antibody : Anti-rabbit-HRP Secondary Antibody Dilution : 1:5000Color/Signal Descriptions : Brown: BMP7 Blue: DAPI Gene Name : Bmp7Submitted by : Christina Theodorpoulos,

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Bmp7 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MVAFFKATEVHLRSIRSTGGKQRSQNRSKTPKNQEALRMASVAENSSSDQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: bone morphogenetic protein 7
• Database Link:
  NP_001178785
  Entrez Gene 655 Human
• Background: The function of Bmp7 remains unknown.
• Synonyms: BMP-7; OP-1; OP1
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 92%; Guinea pig: 86%