ETV5 Rabbit Polyclonal Antibody

CAT#: TA330224

Rabbit Polyclonal Anti-ETV5 Antibody

Product Images

WB Suggested Anti-ETV5 Antibody Titration: 0.2-1 ug/ml; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ETV5 antibody: synthetic peptide directed towards the N terminal of human ETV5. Synthetic peptide located within the following region: AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: ETS variant 5
• Database Link:
  NP_004445
  Entrez Gene 2119 Human
  UniProt ID P41161
• Background: ETV5 Contains 1 ETS DNA-binding domain and belongs to the ETS family. The ETV5 gene expression is regulated by the conventional PKC (cPKC) pathway.ETV5 is subject to SUMO modification and this post-translational modification causes inhibition of transcription-enhancing activity Phosphorylated ETV5 and the actin cytoskeleton regulate CD44-mediated hyaluronan binding in myeloid cells. ERMs (ezrin/radixin/moesin) function as adaptor molecules in the interactions of adhesion receptors and intracellular tyrosine kinases. ETV5 can cooperate with c-Jun and has a role in progression of breast cancer
• Synonyms: ERM
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Transcription Factors