GTF2H2 Rabbit Polyclonal Antibody

CAT#: TA330121

Reviews ()
Write a review

Rabbit Polyclonal Anti-GTF2H2 Antibody


 Product Datasheet for 'TA330121'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the middle region of human GTF2H2. Synthetic peptide located within the following region: HHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Predicted Protein Size 44 kDa
Gene Name general transcription factor IIH subunit 2
Background This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. This gene is within the telomeric copy of the duplication. Deletion of this gene sometimes accompanies deletion of the neighboring SMN1 gene in spinal muscular atrophy (SMA) patients but it is unclear if deletion of this gene contributes to the SMA phenotype. This gene encodes the 44 kDa subunit of RNA polymerase II transcription initiation factor IIH which is involved in basal transcription and nucleotide excision repair. Transcript variants for this gene have been described, but their full length nature has not been determined. A second copy of this gene within the centromeric copy of the duplication has been described in the literature. It is reported to be different by either two or four base pairs; however, no sequence data is currently available for the centromeric copy of the gene. [provided by RefSeq, Jul 2008]
Synonyms BTF2; BTF2P44; p44; T-BTF2P44; TFIIH
Note Immunogen sequence homology: Human: 100%; Dog: 92%; Horse: 92%; Mouse: 85%; Zebrafish: 85%
Reference Data
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Basal transcription factors, Nucleotide excision repair
Other products for "GTF2H2"
Frequently bought together (2)
Transient overexpression lysate of general transcription factor IIH, polypeptide 2, 44kDa (GTF2H2)
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
40% off proteins and antibodies
68 Mouse Clones