OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

FLI1 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA330112
Rabbit Polyclonal Anti-FLI1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY400737 Transient overexpression lysate of Friend leukemia virus integration 1 (FLI1), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP300695 Recombinant protein of human Friend leukemia virus integration 1 (FLI1), 20 µg
20 ug
$867.00

View other "FLI1 or NM_002017" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the middle region of human FLI1. Synthetic peptide located within the following region: FDFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMP
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 51 kDa
Gene Name Fli-1 proto-oncogene, ETS transcription factor
Database Link
Background Friend leukemia integration 1 (Fli-1) is a member of the ETS family of transcriptional regulatory proteins that contain a highly conserved and structurally unique DNA binding ETS domain.
Synonyms EWSR2; SIC-1
Note Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Rabbit: 100%; Mouse: 92%; Rat: 92%; Zebrafish: 92%; African clawed frog: 85%; Horse: 85%
Reference Data
Protein Categories Cancer: Sarcoma, Cardiovascular diseases, Intracellular Proteins, Transciption Factors
Protein Families Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products