Ces2a Rabbit Polyclonal Antibody

CAT#: TA329985

Reviews ()
Write a review

Rabbit Polyclonal Anti-CES6 Antibody


Product Datasheet for 'TA329985'


Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 310.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CES6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MQSGVALLPDLISDTSEVVYKTVANLSGCEATDSEALIHCLRAKSKQEIL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Predicted Protein Size 61 kDa
Gene Name carboxylesterase 2A
Background Mouse Ces6 is a member of carboxylesterases family. Carboxylesterases are enzymes that catalyze the hydrolysis of a wide range of ester-containing endogenous and xenobiotic compounds.
Synonyms 9130231C15Rik; AI266984; Ces6
Note Immunogen sequence homology: Rat: 100%; Mouse: 100%
Reference Data
Other products for "Ces2a"
Frequently bought together (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies