Ddx54 Rabbit Polyclonal Antibody

SKU TA329947

Rabbit Polyclonal Anti-Ddx54 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ddx54 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ISSSYKRDLYQKWKQKQKIDDRDSEEEGPSNQRGPGPRRGGKRGRSQGTS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 98 kDa
• Gene Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 54
• Database Link:
  NP_082317
  Q8K4L0
• Background: Ddx54 has RNA-dependent ATPase activity. Ddx54 represses the transcriptional activity of nuclear receptors
• Synonyms: APR-5; DP97; MGC2835
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Mouse: 100%; Bovine: 100%; Human: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data