Dmrtc2 Rabbit Polyclonal Antibody

SKU TA329945

Rabbit Polyclonal Anti-Dmrtc2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Dmrtc2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Dmrtc2. Synthetic peptide located within the following region: SCLAWTSGPSERQLQREAAEALVGLKDSSQAPRLTPSVPPNPAWISLLHP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: doublesex and mab-3 related transcription factor like family C2
• Database Link:
  NP_082008
  Q8CGW9
• Background: Dmrtc2 may be involved in sexual development.
• Synonyms: DMRTC2
• Note: Immunogen sequence homology: Rat: 100%; Horse: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Human: 93%; Guinea pig: 93%

Reference Data