Toe1 Rabbit Polyclonal Antibody

CAT#: TA329940

Rabbit Polyclonal Anti-Toe1 Antibody

Product Images

WB Suggested Anti-Toe1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Toe1 antibody: synthetic peptide directed towards the middle region of mouse Toe1. Synthetic peptide located within the following region: QSQPGTQTLAEAEDGPPTKQVCEDSLETEKMEQKVAEGEAGDQPGSREGH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: target of EGR1, member 1 (nuclear)
• Database Link:
  NP_080930
  Entrez Gene 68276 Mouse
  UniProt ID Q9D2E2
• Background: Toe1 inhibits cell growth rate and cell cycle. Toe1 induces CDKN1A expression as well as TGF-beta expression.Toe1 mediates the inhibitory growth effect of EGR1.
• Synonyms: FLJ13949
• Note: Immunogen sequence homology: Mouse: 100%