Plbd1 Rabbit Polyclonal Antibody

CAT#: TA329931

Rabbit Polyclonal Anti-Plbd1 Antibody

Product Images

WB Suggested Anti-Plbd1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Plbd1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ESKKVEIKTVLDKNGDAYGYYNDSIKTTGWGILEIRAGYGSQVLSNEIIM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: phospholipase B domain containing 1
• Database Link:
  NP_080082
  Entrez Gene 66857 Mouse
  UniProt ID Q8VCI0
• Background: 1100001H23Rik is a putative phospholipase.
• Synonyms: FLJ22662
• Note: Immunogen sequence homology: Mouse: 100%; Rat: 92%; Dog: 86%; Pig: 86%; Zebrafish: 82%; Guinea pig: 82%; Horse: 79%; Human: 79%; Rabbit: 79%; Bovine: 77%