DVL1 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-DVL1 antibody: synthetic peptide directed towards the middle region of human DVL1. Synthetic peptide located within the following region: LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 38 kDa |
| Gene Name | dishevelled segment polarity protein 1 |
| Database Link | |
| Background | DVL1 is a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 gene is a candidate for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1 gene. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development. |
| Synonyms | DRS2; DVL; DVL1L1; DVL1P1 |
| Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 87% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
| Protein Pathways | Basal cell carcinoma, Colorectal cancer, Melanogenesis, Notch signaling pathway, Pathways in cancer, Wnt signaling pathway |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Secreted phosphoprotein-1 accelerates the progression of human colorectal cancer through activating β-catenin signaling
Yi, Liu, Zhang et al
Oncol Lett (2021) 21 (5), 372 DOI: 10.3892/ol.2021.12633
Yi, Liu, Zhang et al
Oncol Lett (2021) 21 (5), 372 DOI: 10.3892/ol.2021.12633
Cited by 10
AI Summary: OriGene products, specifically three lentiviral vectors for β-catenin silencing (sh‑β‑catenin‑1/‑2/‑3, OriGene Technologies, Inc.), were used in this study to stably knock down β-catenin expression and investigate its role in SPP-1-induced colorectal cancer progression.
Snippet: To silence β‑catenin expression, three lentiviral vectors (sh‑β‑catenin‑1/‑2/‑3;OriGene Technologies, Inc.) and pumomycin (7 µg/ml, incubation for 14 days) were used to select the stably transfected cells no. TA329899;OriGene Technologies, Inc.), TCF (1:2,500 dilution
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
