HEPACAM Rabbit Polyclonal Antibody

CAT#: TA329778

Rabbit polyclonal Anti-HEPACAM Antibody

Product Images

WB Suggested Anti-HEPACAM Antibody Titration: 0.2-1 ug/ml; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HEPACAM antibody: synthetic peptide directed towards the N terminal of human HEPACAM. Synthetic peptide located within the following region: LLLSDLQLADEGTYEVEISITDDTFTGEKTINLTVDVPISRPQVLVASTT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: hepatic and glial cell adhesion molecule
• Database Link:
  NP_689935
  Entrez Gene 220296 Human
  UniProt ID Q14CZ8
• Background: HEPACAM is involved in regulating cell motility and cell-matrix interactions. HEPACAM may inhibit cell growth through suppression of cell proliferation.
• Synonyms: GlialCAM; MLC2A; MLC2B
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane