Mafg Rabbit Polyclonal Antibody

CAT#: TA329748

Rabbit Polyclonal Anti-Mafg Antibody

Product Images

WB Suggested Anti-Mafg Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Mafg antibody is: synthetic peptide directed towards the N-terminal region of Mouse Mafg. Synthetic peptide located within the following region: TPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIIQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: v-maf musculoaponeurotic fibrosarcoma oncogene family, protein G (avian)
• Database Link:
  NP_034886
  Entrez Gene 17134 Mouse
  UniProt ID O54790
• Background: Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF-E2 transcription factor. Transcription factor, component of erythroid-specific transcription factor NF-E2. Mafg activates globin gene expression when associated with NF-E2 and may be involved in signal transduction of extracellular H+.
• Synonyms: hMAF; MGC13090; MGC20149
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%