OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rbfox2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA329611
Rabbit polyclonal anti-Rbfox2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "Rbfox2 or NM_001110827" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-Rbfox2 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Rbfox2. Synthetic peptide located within the following region: PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 47 kDa
Gene Name RNA binding protein, fox-1 homolog (C. elegans) 2
Database Link
Background Rbm9 is a RNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements.Rbm9 prevents binding of U2AF2 to the 3'-splice site. Rbm9 regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis. Rbm9 seems to act as a coregulatory factor of ER-alpha.
Synonyms 2810460A15Rik; AA407676; AI118529; Fbm2; Fxh; Hrnbp2; Rbm9
Note Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 79%; Human: 79%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products