PWWP2A Rabbit Polyclonal Antibody

SKU TA329566

Rabbit polyclonal anti-PWWP2A antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PWWP2A antibody: synthetic peptide directed towards the C terminal of human PWWP2A. Synthetic peptide located within the following region: PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 61 kDa
• Gene Name: PWWP domain containing 2A
• Database Link:
  NP_443159
  Q96N64
• Background: PWWP2A contains 1 PWWP domain. The exact function of PWWP2A remains unknown.
• Synonyms: MST101
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%

Reference Data