MKRN3 Rabbit Polyclonal Antibody

CAT#: TA329564

Rabbit Polyclonal anti-Mkrn3 Antibody

Product Images

Host: Rabbit; Target Name: Mkrn3; Sample Tissue: Rat Spleen lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Mkrn3 antibody is: synthetic peptide directed towards the middle region of Rat Mkrn3. Synthetic peptide located within the following region: ARGGQDSQPRASADRGPKMATHWEPPTQEVAEAPPTASSSSLPLIGSAAE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: makorin ring finger protein 3
• Database Link:
  NP_005655
  Entrez Gene 292988 Rat
  UniProt ID Q13064
• Background: The function of this protein remains unknown.
• Synonyms: CPPB2; D15S9; RNF63; ZFP127; ZNF127
• Note: Immunogen sequence homology: Human: 100%; Mouse: 100%; Rat: 93%; Rabbit: 93%; Pig: 92%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome