SYDE1 Rabbit Polyclonal Antibody

SKU TA329499

Rabbit Polyclonal anti-SYDE1 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SYDE1 antibody: synthetic peptide directed towards the N terminal of human SYDE1. Synthetic peptide located within the following region: PSPPEPEPQAPEGSQAGAEGPSSPEASRSPARGAYLQSLEPSSRRWVLGG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 80 kDa
• Gene Name: synapse defective Rho GTPase homolog 1
• Database Link:
  NP_149014
  Q6ZW31
• Background: SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
• Synonyms: 7h3; SYD1
• Note: Immunogen sequence homology: Human: 100%; Bovine: 92%; Pig: 86%; Guinea pig: 86%; Rabbit: 85%; Dog: 79%; Rat: 79%

Reference Data