ZGPAT Rabbit Polyclonal Antibody

CAT#: TA329497

Rabbit Polyclonal anti-ZGPAT antibody

Product Images

Host: Rabbit; Target Name: ZGPAT; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: ZGPAT; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0ug/ml

• 

  WB Suggested Anti-ZGPAT Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 721_B cell lysateZGPAT is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZGPAT antibody: synthetic peptide directed towards the C terminal of human ZGPAT. Synthetic peptide located within the following region: AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: zinc finger CCCH-type and G-patch domain containing
• Database Link:
  NP_115916
  Entrez Gene 84619 Human
  UniProt ID Q8N5A5
• Background: ZGPAT contains 1 C3H1-type zinc finger and 1 G-patch domain. The function of the ZGPAT protein is not known.
• Synonyms: GPATC6; GPATCH6; KIAA1847; ZC3H9; ZC3HDC9; ZIP
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 79%; Rabbit: 79%