ZGPAT (NM_181485) Human Recombinant Protein
SKU
TP321260
Recombinant protein of human zinc finger, CCCH-type with G patch domain (ZGPAT), transcript variant 3, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC221260 protein sequence
Red=Cloning site Green=Tags(s) MDEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTEASLVSVRKSRLLAALDEER PGRQEDAEYQAFREAITEAVEAPAAARGSGSETVPKAEAGPESAAGGQEEEEGEDEEELSGTKVSAPYYS SWGTLEYHNAMVVGTEEAEDGSAGVRVLYLYPTHKSLKPCPFFLEGKCRFKENCRFSHGQVVSLDELRPF QDPDLSSLQAGSACLAKHQDGLWHAARITDVDNGYYTVKFDSLLLREAVVEGDGILPPLRTEATESDSDS DGTGDSSYARVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRVEPIHAVVLPR GKSLDQCVETLQKQTRVGKAGTNKPPRCRGRGARPGGRPAPRNVFDFLNEKLQGQAPGALEAGAAPAGRR SKDMYHASKSAKRALSLRLFQTEEKIERTQRDIRSIQEALARNAGRHSVASAQLQEKLAGAQRQLGQLRA QEAGLQQEQRKADTHKKMTEF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_852150 |
Locus ID | 84619 |
UniProt ID | Q8N5A5 |
Cytogenetics | 20q13.33 |
RefSeq Size | 1898 |
RefSeq ORF | 1533 |
Synonyms | GPATC6; GPATCH6; KIAA1847; ZC3H9; ZC3HDC9; ZIP |
Summary | Transcription repressor that specifically binds the 5'-GGAG[GA]A[GA]A-3' consensus sequence. Represses transcription by recruiting the chromatin multiprotein complex NuRD to target promoters. Negatively regulates expression of EGFR, a gene involved in cell proliferation, survival and migration. Its ability to repress genes of the EGFR pathway suggest it may act as a tumor suppressor. Able to suppress breast carcinogenesis.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH321260 | ZGPAT MS Standard C13 and N15-labeled recombinant protein (NP_852150) | 10 ug |
$3,255.00
|
|
LC405782 | ZGPAT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC410058 | ZGPAT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY405782 | Transient overexpression lysate of zinc finger, CCCH-type with G patch domain (ZGPAT), transcript variant 3 | 100 ug |
$436.00
|
|
LY410058 | Transient overexpression lysate of zinc finger, CCCH-type with G patch domain (ZGPAT), transcript variant 1 | 100 ug |
$665.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.