ZGPAT (NM_181485) Human Mass Spec Standard

SKU
PH321260
ZGPAT MS Standard C13 and N15-labeled recombinant protein (NP_852150)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221260]
Predicted MW 55.6 kDa
Protein Sequence
Protein Sequence
>RC221260 protein sequence
Red=Cloning site Green=Tags(s)

MDEESLESALQTYRAQLQQVELALGAGLDSSEQADLRQLQGDLKELIELTEASLVSVRKSRLLAALDEER
PGRQEDAEYQAFREAITEAVEAPAAARGSGSETVPKAEAGPESAAGGQEEEEGEDEEELSGTKVSAPYYS
SWGTLEYHNAMVVGTEEAEDGSAGVRVLYLYPTHKSLKPCPFFLEGKCRFKENCRFSHGQVVSLDELRPF
QDPDLSSLQAGSACLAKHQDGLWHAARITDVDNGYYTVKFDSLLLREAVVEGDGILPPLRTEATESDSDS
DGTGDSSYARVVGSDAVDSGTCSSAFAGWEVHTRGIGSRLLTKMGYEFGKGLGRHAEGRVEPIHAVVLPR
GKSLDQCVETLQKQTRVGKAGTNKPPRCRGRGARPGGRPAPRNVFDFLNEKLQGQAPGALEAGAAPAGRR
SKDMYHASKSAKRALSLRLFQTEEKIERTQRDIRSIQEALARNAGRHSVASAQLQEKLAGAQRQLGQLRA
QEAGLQQEQRKADTHKKMTEF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_852150
RefSeq Size 1898
RefSeq ORF 1533
Synonyms GPATC6; GPATCH6; KIAA1847; ZC3H9; ZC3HDC9; ZIP
Locus ID 84619
UniProt ID Q8N5A5
Cytogenetics 20q13.33
Summary Transcription repressor that specifically binds the 5'-GGAG[GA]A[GA]A-3' consensus sequence. Represses transcription by recruiting the chromatin multiprotein complex NuRD to target promoters. Negatively regulates expression of EGFR, a gene involved in cell proliferation, survival and migration. Its ability to repress genes of the EGFR pathway suggest it may act as a tumor suppressor. Able to suppress breast carcinogenesis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ZGPAT (NM_181485) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC405782 ZGPAT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410058 ZGPAT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405782 Transient overexpression lysate of zinc finger, CCCH-type with G patch domain (ZGPAT), transcript variant 3 100 ug
$436.00
LY410058 Transient overexpression lysate of zinc finger, CCCH-type with G patch domain (ZGPAT), transcript variant 1 100 ug
$665.00
TP321260 Recombinant protein of human zinc finger, CCCH-type with G patch domain (ZGPAT), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.