GATA2 Rabbit Polyclonal Antibody

CAT#: TA329422

Rabbit Polyclonal anti-GATA2 antibody

Product Images

Lanes : Lane 1: 30ug mouse liver lysateLane 2: 30 ug mouse N2a cell lysate; Primary Antibody Dilution : 1:500; Secondary Antibody : Anti-rabbit-HRP; Secondary Antibody Dilution : 1:2500; Gene Name : GATA2; Submitted by : A Kalyani and Vinayak Gupta IIT Madras

• 

  WB Suggested Anti-GATA2 Antibody Titration: 1.0-2.0 ug/ml; ELISA Titer: 1:1562500; Positive Control: K562 cell lysateGATA2 is strongly supported by BioGPS gene expression data to be expressed in Human K562 cells

• 

  Human Liver

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GATA2 antibody: synthetic peptide directed towards the N terminal of human GATA2. Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: GATA binding protein 2
• Database Link:
  NP_116027
  Entrez Gene 14461 MouseEntrez Gene 2624 Human
  UniProt ID P23769
• Background: The GATA family of transcription factors, which contain zinc fingers in their DNA binding domain, have emerged as candidate regulators of gene expression in hematopoietic cells is essential for normal primitive and definitive erythropoiesis and is expressed at high levels in erythroid cells, mast cells, and megakaryocytes. GATA2 is expressed in hematopoietic progenitors, including early erythroid cells, mast cells, and megakaryocytes, and also in nonhematopoietic embryonic stem cells.
• Synonyms: DCML; IMD21; MONOMAC; NFE1B
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Adult stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors