ZNF652 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | IHC, WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ZNF652 antibody: synthetic peptide directed towards the N terminal of human ZNF652. Synthetic peptide located within the following region: RENSDDTEEEEEEVSYKREQIIVEVNLNNQTLNVSKGEKGVSSQSKETPV |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 70 kDa |
| Gene Name | zinc finger protein 652 |
| Database Link | |
| Background | ZNF652 is a new candidate transcription factor. |
| Synonyms | DKFZp781E2122; KIAA0924 |
| Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 93%; Mouse: 93%; Goat: 91%; Yeast: 91%; Rabbit: 90%; Bovine: 88%; Horse: 87%; Pig: 78% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Transciption Factors |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
ZNF652 exerts a tumor suppressor role in lung cancer by transcriptionally downregulating cyclin D3
Xie, Zhou, Wu et al
Cell Death Dis (2024) 15 (11), 792 DOI: 10.1038/s41419-024-07197-1
Xie, Zhou, Wu et al
Cell Death Dis (2024) 15 (11), 792 DOI: 10.1038/s41419-024-07197-1
Cited by 11
AI Summary: OriGene’s ZNF652 primary antibody (#TA329381) was used in this study to detect ZNF652 protein levels, enabling the authors to investigate its tumor suppressor role in lung cancer.
Snippet: The protocol was performed as described previously [24]. The primary antibody against ZNF652 (#TA329381) was purchased from Origene Technologies (Rockville, MD, USA). Primary antibodies against E-cadherin (#20874-1-AP)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
