ZNF474 Rabbit Polyclonal Antibody

CAT#: TA329332

Rabbit Polyclonal anti-ZNF474 antibody

Product Images

WB Suggested Anti-ZNF474 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Stomach

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF474 antibody: synthetic peptide directed towards the middle region of human ZNF474. Synthetic peptide located within the following region: NDRLPVELHQPLPQKPQPLPNAQSSQAGPNQAQLVFCPHCSRIFTSDRLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: zinc finger protein 474
• Database Link:
  NP_997200
  Entrez Gene 133923 Human
  UniProt ID Q6S9Z5
• Background: The specific function of ZNF474 is not yet known.
• Synonyms: FLJ32921
• Note: Immunogen sequence homology: Human: 100%; Mouse: 85%; Rat: 77%