Nfe2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-Nfe2 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Nfe2. Synthetic peptide located within the following region: ARGEADRTLEVMRQQLAELYHDIFQHLRDESGNSYSPEEYVLQQAADGAI |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 41 kDa |
| Gene Name | nuclear factor, erythroid derived 2 |
| Database Link | |
| Background | Nfe2 is a component of the NF-E2 complex essential for regulating erythroid and megakaryocytic maturation and differentiation.It binds to the hypersensitive site 2 (HS2) of the beta-globin control region (LCR). This subunit (NFE2) recognizes the TCAT/C sequence of the AP-1-like core palindrome present in a number of erythroid and megakaryocytic gene promoters. It requires MAFK or other small MAF proteins for binding to the NF-E2 motif. It may play a role in all aspects of hemoglobin production from globin and heme synthesis to procurement of iron. |
| Synonyms | NF-E2; p45 |
| Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 86%; Horse: 79% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Transciption Factors |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Punicalagin improves hepatic lipid metabolism via modulation of oxidative stress and mitochondrial biogenesis in hyperlipidemic mice
Cao, Wang, Yang et al
Food Funct (2020) 11 (11), 9624-9633 DOI: 10.1039/d0fo01545h
Cao, Wang, Yang et al
Food Funct (2020) 11 (11), 9624-9633 DOI: 10.1039/d0fo01545h
Cited by 36
AI Summary: In this study, OriGene’s anti-Nrf2 antibody (Cat# TA327186) and PGC-1α antibody (Cat# TA322663) were used for protein detection by Western blot, contributing to the investigation of punicalagin’s effects on oxidative stress and mitochondrial biogenesis in hyperlipidemic mice.
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
