OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ccl20 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA329180
Rabbit Polyclonal anti-Ccl20 antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (1)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00

View other "Ccl20 or NM_019233" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Rat
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Ccl20 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 11 kDa
Gene Name C-C motif chemokine ligand 20
Database Link
Background Ccl20 is a chemotactic factor that attracts lymphocytes and, slightly, neutrophils, but not monocytes. Ccl20 may play a role in modulating inflammatory cell recruitment to the CNS and therefore contribute to tissue injury in ischemic stroke and autoimmune diseases.
Synonyms CKb4; exodus-1; LARC; MIP-3-alpha; MIP-3a; MIP3A; SCYA20; ST38
Note Immunogen sequence homology: Human: 100%; Rat: 94%; Pig: 88%; Horse: 88%; Mouse: 88%; Rabbit: 88%; Guinea pig: 88%; Dog: 85%
Reference Data
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products