FOXM1 Rabbit Polyclonal Antibody

CAT#: TA329179

Rabbit Polyclonal anti-FOXM1 antibody

Product Images

WB Suggested Anti-FOXM1 Antibody Titration: 1 ug/ml; Positive Control: THP-1 cell lysate

• 

  Jurkat

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXM1 antibody: synthetic peptide directed towards the N terminal of human FOXM1. Synthetic peptide located within the following region: LKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 88 kDa
• Gene Name: forkhead box M1
• Database Link:
  NP_973731
  Entrez Gene 2305 Human
  UniProt ID Q08050
• Background: This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
• Synonyms: FKHL16; FOXM1B; HFH-11; HFH11; HNF-3; INS-1; MPHOSPH2; MPP-2; MPP2; PIG29; TGT3; TRIDENT
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors