TLR2 Rabbit Polyclonal Antibody

CAT#: TA329156

Rabbit Polyclonal anti-TLR2 antibody

Product Images

TLR2 antibody - C-terminal region validated by WB using Fetal Brain Lysate at 1ug/ml.

• 

  IHC Information: Lung

• 

  IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)

• 

  Sample Type: Human Macrophange Cells; Green: primary; Red: phallodin; Blue: DAPI; Yellow: green/red; Primary Dilution: 1:200; Secondary Antibody: anti-Rabbit IgG-FITC; Secondary Dilution: 1:1000; Image Submitted By: Milan Fiala; University of California, Los Angeles

• 

  Immunohistochemistry with pFA fixed human thymus tissue tissue

• 

  Immunohistochemistry with Liver tissue at an antibody concentration of 5.0ug/ml using anti-TLR2 antibody

Show all 6 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TLR2 antibody: synthetic peptide directed towards the C terminal of human TLR2. Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 90 kDa
• Gene Name: toll like receptor 2
• Database Link:
  NP_003255
  Entrez Gene 7097 Human
  UniProt ID O60603
• Background: TLR2 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CD282; TIL4
• Note: Immunogen sequence homology: Human: 100%; Zebrafish: 100%; Rat: 92%; Horse: 92%; Mouse: 91%; Sheep: 91%; Bovine: 91%; Dog: 85%; Goat: 85%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Toll-like receptor signaling pathway