OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GFI1B Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA329111
Rabbit Polyclonal anti-GFI1B antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY418158 Transient overexpression lysate of growth factor independent 1B transcription repressor (GFI1B), transcript variant 1 (as WB positive control) 100 ug
$436.00

View other "GFI1B or NM_004188" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GFI1B antibody: synthetic peptide directed towards the N terminal of human GFI1B. Synthetic peptide located within the following region: MPRSFLVKSKMAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLF
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 38 kDa
Gene Name growth factor independent 1B transcriptional repressor
Database Link
Background GFI1B acts in the late stage of erythroid differentiation as a transcriptional repressor. GATA-1 and NF-Y both contribute to erythroid-specific transcriptional activation of the Gfi-1B promoter. This zinc finger protein mediates erythroid expansion and has a role in normal erythropoiesis.
Synonyms BDPLT17; ZNF163B
Note Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Goat: 83%; Mouse: 83%; Bovine: 83%; Rat: 82%
Reference Data
Protein Categories Cardiovascular diseases, Growth Factors, Intracellular Proteins, Transciption Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products