TPRA1 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-TPRA1 Antibody is: synthetic peptide directed towards the C-terminal region of Human TPRA1. Synthetic peptide located within the following region: SFFAPLIYVAFLRGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARRE |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 40 kDa |
| Gene Name | transmembrane protein adipocyte associated 1 |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | GPR175; TMEM227; TPRA40 |
| Note | Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Mouse: 86%; Guinea pig: 86% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Membrane Proteins |
| Protein Families | Druggable Genome, Transmembrane |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Identification of TPRA1 as a Novel Receptor and Predictive Biomarker for Oncolytic Virus M1
Hu, Zhang, Lin et al
Adv Sci (Weinh) (2025)
Hu, Zhang, Lin et al
Adv Sci (Weinh) (2025)
AI Summary: OriGene contributed to this study by providing the anti-TPRA1 antibody (OriGene#TA334080), which was used to detect TPRA1 protein expression and validate its role as a novel receptor and predictive biomarker for oncolytic virus M1.
Snippet: The membranes were blocked with 5% non-fat milk for 2 h at room temperature (RT) and then incubated overnight at 4 °C with the following primary antibodies: anti-TPRA1 (Origene#TA334080), anti-HA (Cell Signaling Technology#3724), anti-β-Tubulin (Abcam#ab6046), anti-β-Actin (Affinity#AF7018),
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
