OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC85C (NM_001144995) Human Mass Spec Standard

Be the first to review this product
SKU
PH327995
CCDC85C MS Standard C13 and N15-labeled recombinant protein (NP_001138467)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA367948 CCDC85C rabbit polyclonal antibody
100 ul
$310.00
LY428630 Transient overexpression lysate of coiled-coil domain containing 85C (CCDC85C) (as WB positive control) 100 ug
$436.00

Other products for "CCDC85C or NM_001144995"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227995
Predicted MW 45 kDa
Protein Sequence
Protein Sequence
>RC227995 representing NM_001144995
Red=Cloning site Green=Tags(s)

MAKPAATAAAASEELSQVPDEELLRWSKEELARRLRRAEGEKVGLMLEHGGLMRDVNRRLQQHLLEIRGL
KDVNQRLQDDNQELRELCCFLDDDRQKGRKLAREWQRFGRHAAGAVWHEVARSQQKLRELEARQEALLRE
NLELKELVLLLDEERAALAATGAASGGGGGGGGAGSRSSIDSQASLSGPLSGGAPGAGARDVGDGSSTSS
AGSGGSPDHHHHVPPPLLPPGPHKAPDGKAGATRRSLDDLSAPPHHRSIPNGLHDPSSTYIRQLESKVRL
LEGDKLLAQQAGSGEFRTLRKGFSPYHSESQLASLPPSYQDSLQNGPACPAPELPSPPSAGYSPAGQKPE
AVVHAMKVLEVHENLDRQLQDSCEEDLSEKEKAIVREMCNVVWRKLGDAASSKPSIRQHLSGNQFKGPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001138467
RefSeq ORF 1257
Locus ID 317762
UniProt ID A6NKD9
Cytogenetics 14q32.2
Summary May play an important role in cortical development, especially in the maintenance of radial glia.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CCDC85C" proteins (3)
SKU Description Size Price
LC428630 Lyophilized CCDC85C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY428630 Transient overexpression lysate of coiled-coil domain containing 85C (CCDC85C) (as WB positive control) 100 ug
$436.00
TP327995 Purified recombinant protein of Homo sapiens coiled-coil domain containing 85C (CCDC85C), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products