OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRAPPC3L (NM_001139444) Human Mass Spec Standard

Be the first to review this product
SKU
PH327688
BET3L MS Standard C13 and N15-labeled recombinant protein (NP_001132916)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY427960 Transient overexpression lysate of BET3 like (S. cerevisiae) (BET3L) (as WB positive control) 100 ug
$436.00

Other products for "TRAPPC3L or NM_001139444"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227688
Predicted MW 20.4 kDa
Protein Sequence
Protein Sequence
>RC227688 representing NM_001139444
Red=Cloning site Green=Tags(s)

MSRPAHRRPEYHKINKDLFVLTYGALVAQLCKDYEKDEDVNQYLDKMGYGIGTRLVEDFLARSCVGRCHS
YSEIIDIIAQVAFKMYLGITPSVTCNNSSKNEFSLILEKNPLVEFVEELPAGRSSLCYCNLLCGIIRGAL
EMVHLAADVTFLQDRLKGDSVTEIGITFLKKRDEKKYRGKK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001132916
RefSeq ORF 543
Synonyms bA259P20.2; BET3L
Locus ID 100128327
UniProt ID Q5T215
Cytogenetics 6q22.1
Summary May play a role in vesicular transport from endoplasmic reticulum to Golgi.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TRAPPC3L" proteins (3)
SKU Description Size Price
LC427960 Lyophilized TRAPPC3L HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY427960 Transient overexpression lysate of BET3 like (S. cerevisiae) (BET3L) (as WB positive control) 100 ug
$436.00
TP327688 Recombinant protein of human BET3 like (S. cerevisiae) (BET3L), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products