OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SPNS1 (NM_001142448) Human Mass Spec Standard

Be the first to review this product
SKU
PH327635
SPNS1 MS Standard C13 and N15-labeled recombinant protein (NP_001135920)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA326706 Rabbit Polyclonal SPINSTER Antibody
100 ug
$640.00
LY410347 Transient overexpression lysate of spinster homolog 1 (Drosophila) (SPNS1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "SPNS1 or NM_001142448"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC227635
Predicted MW 56.6 kDa
Protein Sequence
Protein Sequence
>RC227635 protein sequence
Red=Cloning site Green=Tags(s)

MAGSDTAPFLSQADDPDDGPVPGTPGLPGSTGNPKSEEPEVPDQEGLQRITGLSPGRSALIVAVLCYINL
LNYMDRFTVAGVLPDIEQFFNIGDSSSGLIQTVFISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTL
GSSFIPGEHFWLLLLTRGLVGVGEASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVK
DMAGDWHWALRVTPGLGVVAVLLLFLVVREPPRGAVERHSDLPPLNPTSWWADLRALARNPSFVLSSLGF
TAVAFVTGSLALWAPAFLLRSRVVLGETPPCLPGDSCSSSDSLIFGLITCLTGVLGVGLGVEISRRLRHS
NPRADPLVCATGLLGSAPFLFLSLACARGSIVATYIFIFIGETLLSMNWAIVADILLYVVIPTRRSTAEA
FQIVLSHLLGDAGSPYLIGLISDRLRRNWPPSFLSEFRALQFSLMLCAFVGALGGAAFLGTAIFIEADRR
RAQLHVQGLLHEAGSTDDRIVVPQRGRSTRVPVASVLI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001135920
RefSeq Size 1993
RefSeq ORF 1584
Synonyms HSpin1; LAT; nrs; PP2030; SLC62A1; SPIN1; SPINL
Locus ID 83985
UniProt ID Q9H2V7
Cytogenetics 16p11.2
Summary Sphingolipid transporter (By similarity). May be involved in necrotic or autophagic cell death.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SPNS1" proteins (7)
SKU Description Size Price
PH303567 SPNS1 MS Standard C13 and N15-labeled recombinant protein (NP_114427) 10 ug
$3,360.00
LC410347 Lyophilized SPNS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC428102 Lyophilized SPNS1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410347 Transient overexpression lysate of spinster homolog 1 (Drosophila) (SPNS1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY428102 Transient overexpression lysate of spinster homolog 1 (Drosophila) (SPNS1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP303567 Purified recombinant protein of Homo sapiens spinster homolog 1 (Drosophila) (SPNS1), transcript variant 1, 20 µg 20 ug
$867.00
TP327635 Purified recombinant protein of Homo sapiens spinster homolog 1 (Drosophila) (SPNS1), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products